Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d027536_circ_g.2 |
| ID in PlantcircBase | zma_circ_006388 |
| Alias | Zm01circ00023 |
| Organism | Zea mays |
| Position | chr1: 7689009-7697438 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d027536 |
| Parent gene annotation |
Serine acetyltransferase 4 |
| Parent gene strand | - |
| Alternative splicing | Zm00001d027536_circ_g.1 |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d027536_T005:2 Zm00001d027536_T008:2 Zm00001d027536_T002:2 Zm00001d027536_T007:2 Zm00001d027536_T003:2 Zm00001d027536_T009:2 Zm00001d027536_T004:2 Zm00001d027536_T006:2 Zm00001d027536_T001:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.056247424 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7697405-7689072(+) 7697351-7697383(-) |
| Potential amino acid sequence |
MIQQYSLANFGSCGEVRPLKQGSQQQSWHLRLH*(+) MQGVTLGGTGKEHGDRHPKIGQGALIGASATILGNINVGEGAMIAAGSLVLKDVPPHSCQNWRG NIVGSWNRSSHW*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Han et al., 2020 |