Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0471900_circ_g.1 |
ID in PlantcircBase | osa_circ_037318 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 23220758-23221378 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0471900 |
Parent gene annotation |
Zinc finger, ZPR1-type domain containing protein. (Os08t0471900- 01) |
Parent gene strand | - |
Alternative splicing | Os08g0471900_circ_g.2 Os08g0471900_circ_g.3 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os08t0471900-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.149895867 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23221294-23220776(+) |
Potential amino acid sequence |
MTSRVRSFPFCTRSVIFFPLAGISPPGFNLAYFHN*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |