Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0361900_circ_g.2 |
ID in PlantcircBase | osa_circ_027606 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 17279247-17280380 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0361900 |
Parent gene annotation |
Mitochondrial carrier protein domain containing protein. (Os05t0 361900-01);Similar to Mitochondrial carrier C12B10.09. (Os05t036 1900-02);Similar to Mitochondrial carrier C12B10.09. (Os05t03619 00-04) |
Parent gene strand | - |
Alternative splicing | Os05g0361900_circ_g.1 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os05t0361900-04:3 Os05t0361900-02:3 Os05t0361900-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_006190* |
PMCS | 0.113401235 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17280095-17280094(+) 17280364-17280094(-) 17279299-17280094(-) |
Potential amino acid sequence |
MTPSHRIWRKLKGFSSSPPTAMPPCCNKGEHQQYFQLIQNTILSIEFDFLPEQPEAWFLSYQSG TELFPPPHPRCHQL*(+) MAVGGEEEKPFNFLQILCEGVIAGGTAGVVVETALYPIDTIKTRLQAARGGSQIQWKGLYSGLA GNIAGVLPCCSKEAWRWGVKKRSPSTSSRFCVRAS*(-) MERIVFWISWKYCWCSPLLQQGGMAVGGEEEKPFNFLQILCEGVIAGGTAGVVVETALYPIDTI KTRLQAARGGSQIQWKGLYSGLAGNIAGVLPCCSKEAWRWGVKKRSPSTSSRFCVRAS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |