Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0361900_circ_g.2 |
| ID in PlantcircBase | osa_circ_027606 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 17279247-17280380 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0361900 |
| Parent gene annotation |
Mitochondrial carrier protein domain containing protein. (Os05t0 361900-01);Similar to Mitochondrial carrier C12B10.09. (Os05t036 1900-02);Similar to Mitochondrial carrier C12B10.09. (Os05t03619 00-04) |
| Parent gene strand | - |
| Alternative splicing | Os05g0361900_circ_g.1 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0361900-04:3 Os05t0361900-02:3 Os05t0361900-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_006190* |
| PMCS | 0.113401235 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17280095-17280094(+) 17280364-17280094(-) 17279299-17280094(-) |
| Potential amino acid sequence |
MTPSHRIWRKLKGFSSSPPTAMPPCCNKGEHQQYFQLIQNTILSIEFDFLPEQPEAWFLSYQSG TELFPPPHPRCHQL*(+) MAVGGEEEKPFNFLQILCEGVIAGGTAGVVVETALYPIDTIKTRLQAARGGSQIQWKGLYSGLA GNIAGVLPCCSKEAWRWGVKKRSPSTSSRFCVRAS*(-) MERIVFWISWKYCWCSPLLQQGGMAVGGEEEKPFNFLQILCEGVIAGGTAGVVVETALYPIDTI KTRLQAARGGSQIQWKGLYSGLAGNIAGVLPCCSKEAWRWGVKKRSPSTSSRFCVRAS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |