Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0628200_circ_g.1 |
| ID in PlantcircBase | osa_circ_015666 |
| Alias | Os_ciR2268 |
| Organism | Oryza sativa |
| Position | chr2: 25121236-25121687 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os02g0628200 |
| Parent gene annotation |
Protein of unknown function DUF250 domain containing protein. (O s02t0628200-01);Similar to Integral membrane protein like. (Os02 t0628200-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 5/7 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0628200-01:2 Os02t0628200-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.538954074 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25121345-25121552(-) |
| Potential amino acid sequence |
MARPERTDPRRFNLRSVTEAMPTPSSRISRENLILSHDWSRVFVGEDTAAGEELIHEGAGCEQD RRLVRRGLIQKLRRRDL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |