Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0628200_circ_g.1 |
ID in PlantcircBase | osa_circ_015666 |
Alias | Os_ciR2268 |
Organism | Oryza sativa |
Position | chr2: 25121236-25121687 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os02g0628200 |
Parent gene annotation |
Protein of unknown function DUF250 domain containing protein. (O s02t0628200-01);Similar to Integral membrane protein like. (Os02 t0628200-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 5/7 |
Tissues | root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0628200-01:2 Os02t0628200-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.538954074 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
25121345-25121552(-) |
Potential amino acid sequence |
MARPERTDPRRFNLRSVTEAMPTPSSRISRENLILSHDWSRVFVGEDTAAGEELIHEGAGCEQD RRLVRRGLIQKLRRRDL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |