Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0313500_circ_g.1 |
ID in PlantcircBase | osa_circ_014436 |
Alias | Os_ciR7650 |
Organism | Oryza sativa |
Position | chr2: 12383068-12383625 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Os02g0313500 |
Parent gene annotation |
Conserved hypothetical protein. (Os02t0313500-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0313500-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.252008811 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
12383165-12383134(+) 12383089-12383555(-) |
Potential amino acid sequence |
MSAGGAFGGNRGVRPVPPEKGVFPLDHLHECDLEKKDYLACLKSTGFQSEKCRQFSKKYLECRM ERVSTESAFPPLVATHLGSSGGAV*(+) MRIQLKPSPSYIPGTSSRTADIFRTEIQLI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |