Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0313500_circ_g.1 |
| ID in PlantcircBase | osa_circ_014436 |
| Alias | Os_ciR7650 |
| Organism | Oryza sativa |
| Position | chr2: 12383068-12383625 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Os02g0313500 |
| Parent gene annotation |
Conserved hypothetical protein. (Os02t0313500-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0313500-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.252008811 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12383165-12383134(+) 12383089-12383555(-) |
| Potential amino acid sequence |
MSAGGAFGGNRGVRPVPPEKGVFPLDHLHECDLEKKDYLACLKSTGFQSEKCRQFSKKYLECRM ERVSTESAFPPLVATHLGSSGGAV*(+) MRIQLKPSPSYIPGTSSRTADIFRTEIQLI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |