Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0604600_circ_g.1 |
| ID in PlantcircBase | osa_circ_020626 |
| Alias | Os_ciR8667 |
| Organism | Oryza sativa |
| Position | chr3: 22673486-22674042 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os03g0604600 |
| Parent gene annotation |
Hypothetical conserved gene. (Os03t0604600-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0604600-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.246061984 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22673986-22673967(+) 22673648-22674008(-) 22673632-22673995(-) |
| Potential amino acid sequence |
MLIYLQNSKLNFQILLSLNSCCMKNSAPRCFNHGSFASFHCLSGCFSSCNFLPCHSRVVRIGTS QSLIKRCSHAIALLKTLYLSLQVWFSLLPREPIYRGTTFTIN*(+) MTASLDETLGSANPHYTRMAREKIAAREAARKAMEARKAAMVEASWCRILHAARVQAQENLEVQ F*(-) MRLWEVPILTTREWQGRKLQLEKQPERQWKLAKLPWLKHRGAEFFMQQEFKLKRIWKFNFEFCK *(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |