Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0367900_circ_g.2 |
ID in PlantcircBase | osa_circ_019971 |
Alias | Os03circ16158/Os_ciR5331 |
Organism | Oryza sativa |
Position | chr3: 14433075-14433950 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, SMALT, Segemehl, find_circ |
Parent gene | Os03g0367900 |
Parent gene annotation |
Peptidase C15, pyroglutamyl peptidase I family protein. (Os03t03 67900-01);Peptidase C15, pyroglutamyl peptidase I family protein . (Os03t0367900-02) |
Parent gene strand | + |
Alternative splicing | Os03g0367900_circ_g.3 |
Support reads | 2/3/2 |
Tissues | leaf/root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0367900-01:3 Os03t0367900-02:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_004839* osi_circ_013066 |
PMCS | 0.35024532 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14433127-14433080(+) 14433187-14433944(-) |
Potential amino acid sequence |
MGSEGPSGVTVHVTGFKKFHGVAENPTEKIVRNLESFMEKRGLPKGLTLGSCTVLETAGQGGLG PLYEVFESAIVDKEYGLNDQGQVILLHFGVNSGTTRFALENQAINEATFRCPDELGWKPQRAPI VSSDGSISNLRKIV*(+) MELLESSNVNGNTRRSFRTHLSGYETKLTKENMQSHNLS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |