Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0367900_circ_g.2 |
| ID in PlantcircBase | osa_circ_019971 |
| Alias | Os03circ16158/Os_ciR5331 |
| Organism | Oryza sativa |
| Position | chr3: 14433075-14433950 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl, find_circ |
| Parent gene | Os03g0367900 |
| Parent gene annotation |
Peptidase C15, pyroglutamyl peptidase I family protein. (Os03t03 67900-01);Peptidase C15, pyroglutamyl peptidase I family protein . (Os03t0367900-02) |
| Parent gene strand | + |
| Alternative splicing | Os03g0367900_circ_g.3 |
| Support reads | 2/3/2 |
| Tissues | leaf/root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0367900-01:3 Os03t0367900-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_004839* osi_circ_013066 |
| PMCS | 0.35024532 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14433127-14433080(+) 14433187-14433944(-) |
| Potential amino acid sequence |
MGSEGPSGVTVHVTGFKKFHGVAENPTEKIVRNLESFMEKRGLPKGLTLGSCTVLETAGQGGLG PLYEVFESAIVDKEYGLNDQGQVILLHFGVNSGTTRFALENQAINEATFRCPDELGWKPQRAPI VSSDGSISNLRKIV*(+) MELLESSNVNGNTRRSFRTHLSGYETKLTKENMQSHNLS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |