Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G70760_circ_g.3 |
| ID in PlantcircBase | ath_circ_009541 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 26687665-26687772 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT1G70760 |
| Parent gene annotation |
NAD(P)H-quinone oxidoreductase subunit L, chloroplastic |
| Parent gene strand | + |
| Alternative splicing | AT1G70760_circ_g.2 |
| Support reads | 7 |
| Tissues | aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G70760.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.155866667 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26687767-26687769(+) 26687745-26687667(-) |
| Potential amino acid sequence |
MPIDHPALAITGVNNQQELSSVVLDIGIISVWYFLVMPIDHPALAITGVNNQQELSSVVLDIGI ISVWYFLVMPIDHPALAITGVNNQQELSSVVLDIGIISVWYFLVMP(+) MIPISSTTLLNSCWLLTPVIAKAGWSIGITRKYQTDMIPISSTTLLNSCWLLTPVIAKAGWSIG ITRKYQTDMIPISSTTLLNSCWLLTPVIAKAGWSIGITRKYQTDMIPISSTTLLNSCWLLTPVI AKAGWS(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |