Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0276000_circ_g.3 |
| ID in PlantcircBase | osa_circ_036563 |
| Alias | NA, |
| Organism | Oryza sativa |
| Position | chr8: 10623907-10624208 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, CIRI-long |
| Parent gene | Os08g0276000 |
| Parent gene annotation |
Similar to Transmembrane 9 superfamily protein member 4. (Os08t0 276000-01) |
| Parent gene strand | - |
| Alternative splicing | Os08g0276000_circ_g.4 |
| Support reads | 2 |
| Tissues | shoot, root, root, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0276000-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.369518184 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10624019-10624121(-) |
| Potential amino acid sequence |
MILDNLPLVVPIKRMDQEGAYFYQHVFHVGAKGQYARFEMREPQMLSNSLQDFCRGERSKDSQG KD*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017; this study |