Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.002G170500_circ_g.1 |
| ID in PlantcircBase | gra_circ_000181 |
| Alias | Chr02:42789964|42790387 |
| Organism | Gossypium raimondii |
| Position | chrChr02: 42789964-42790387 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.002G170500 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 5/27 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.002G170500.5:1 Gorai.002G170500.4:2 Gorai.002G170500.1:2 Gorai.002G170500.3:2 Gorai.002G170500.6:1 Gorai.002G170500.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 1.066236399 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
42790247-42789975(+) 42790025-42790325(-) |
| Potential amino acid sequence |
MLALVGVFYPYNRGALFTALVVIYALTSGIAGYVATSFYCQLEGTNWVRSR*(+) MNILPSSLFLIISCFFILTVPSLSLQADSRKKLLRSLQSLT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |