Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G30160_circ_g.10 |
| ID in PlantcircBase | ath_circ_033601 |
| Alias | At_ciR4862 |
| Organism | Arabidpsis thaliana |
| Position | chr4: 14757039-14757389 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | AT4G30160 |
| Parent gene annotation |
villin 4 |
| Parent gene strand | + |
| Alternative splicing | AT4G30160_circ_g.3 AT4G30160_circ_g.4 AT4G30160_circ_g.5 AT4G30160_circ_g.6 AT4G30160_circ_g.7 AT4G30160_circ_g.8 AT4G30160_circ_g.9 |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT4G30160.2:2 AT4G30160.1:2 AT4G30160.4:2 AT4G30160.3:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.262535257 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14757153-14757386(+) |
| Potential amino acid sequence |
MQAIQVDPVAASLNSSYYYILHNDSSVFTWAGNLSTATDQELAERQLDLIKGGISSGYKKYIAE KEVDDDTYNENGVALFRIQGSGPENMQAIQVDPVAASLNSSYYYILHNDSSVFTWAGNLSTATD QELAERQLDLIKGGISSGYKKYIAEKEVDDDTYNENGVALFRIQGSGPENMQAIQVDPVAASLN SSYYYILHNDSSVFTWAGNLSTATDQELAERQLDLIKGGISSGYKKYIAEKEVDDDTYNENGVA LFRIQGSGPENMQAIQVDPVAASLNSSYYYILHNDSSVFTWAGNLSTATDQELAERQLDLIK(+ ) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |