Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0640000_circ_g.1 |
| ID in PlantcircBase | osa_circ_034963 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 26635480-26636156 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0640000 |
| Parent gene annotation |
Similar to PRMT3 (PROTEIN ARGININE METHYLTRANSFERASE 3); methylt ransferase/ zinc ion binding. (Os07t0640000-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0640000-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.287285857 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26635539-26635491(+) 26635730-26636154(-) |
| Potential amino acid sequence |
MVSVATEVAKSNGFLYDENMEMQQKRDTQVITVVHTKAEELNHKIQVPSNKFDVLVSEWMGYCL LYESMLSSVLYARDHFLKPGGAILPDTATIFGAGFGKGGTSLPFWENVYGFDMSCIGKEVTGNS ARFPVVDILASEDIVTETAVLNSFCS*(+) MNNSYHLSISLLLHLHIFIVQKTITFCNFSSDRNHLCTPVNSNNSRSTSLSCKKN*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |