Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Solyc10g080660.1_circ_g.1 |
ID in PlantcircBase | sly_circ_003182 |
Alias | NA |
Organism | Solanum lycopersicum |
Position | chr10: 61884122-61885912 JBrowse» |
Reference genome | SL2.50.38 |
Type | e-circRNA |
Identification method | CIRI |
Parent gene | Solyc10g080660.1 |
Parent gene annotation |
protein_coding |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2 |
Tissues | fruit |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Solyc10g080660.1.1:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.158175861 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
61885865-61884168(+) 61884140-61885660(-) |
Potential amino acid sequence |
MLMGEPSGSSKPKTLQPADLTHYDSIHSRCLH*(+) MRQISRLKGFGFATATWLAHQHCPAQLICIFSERVFVLYGRMLLIAMVGSG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Zuo et al., 2016 |