Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.008G169700_circ_g.1 |
| ID in PlantcircBase | gra_circ_000854 |
| Alias | Chr08:44380185|44381123 |
| Organism | Gossypium raimondii |
| Position | chrChr08: 44380185-44381123 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.008G169700 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.008G169700.4:3 Gorai.008G169700.2:3 Gorai.008G169700.3:3 Gorai.008G169700.1:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.133157055 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
44380386-44381077(-) 44380275-44381117(-) |
| Potential amino acid sequence |
MVFTILLMGWLWEVHFCFMDLLVGGPELYFCLHTSFPKSWDSTISYCRKVGQIC*(-) MALGSAFLLHGSVGGWSRTLFLLAHELPQELG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |