Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G24520_circ_g.3 |
ID in PlantcircBase | ath_circ_014671 |
Alias | AT2G24520_C1, CircAHA5 |
Organism | Arabidpsis thaliana |
Position | chr2: 10418493-10418653 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | AT2G24520 |
Parent gene annotation |
H(+)-ATPase 5 |
Parent gene strand | + |
Alternative splicing | AT2G24520_circ_g.2 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT2G24520.3:1 AT2G24520.1:1 AT2G24520.4:1 AT2G24520.2:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.551542305 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
10418502-10418501(+) |
Potential amino acid sequence |
MTISKDRMKPSPQPDSWKLRDIFSTGVVLGGYQALMTVVFFWVMKDSDFFSEQS* |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Zhang et al., 2019 |