Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0382300_circ_g.1 |
| ID in PlantcircBase | osa_circ_006677 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 12331439-12333723 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0382300 |
| Parent gene annotation |
Similar to Signal peptide containing large protein with proline stretches. (Os10t0382300-01);Similar to Signal peptide containin g large protein with proline stretches. (Os10t0382300-02) |
| Parent gene strand | + |
| Alternative splicing | Os10g0382300_circ_g.2 Os10g0382300_circ_g.3 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os10t0382300-02:4 Os10t0382300-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_002793* |
| PMCS | 0.120237885 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12331527-12331458(+) 12333713-12331458(+) 12331487-12331931(-) |
| Potential amino acid sequence |
MTLRYLISIHKLLCSRQGISSPISNLTERLLFDDRDPPAVPQECSLEAPPFDEVDVQALAHAVE LTRQGAVDSLKFAKGDLFQAFQNELCRMKLDLPLLDKLIHEYCIYRGIVEGGSHVLPVVYKEAI *(+) MSFLWSIKKRFELAGLLSSILRTHLQAYDPILSMTLRYLISIHKLLCSRQGISSPISNLTERLL FDDRDPPAVPQECSLEAPPFDEVDVQALAHAVELTRQGAVDSLKFAKGDLFQAFQNELCRMKLD LPLLDKLIHEYCIYRGIVEGGSHVLPVVYKEAI*(+) MDDSNPASSNRFFIDHRKDMGTTFNYSPVYTVLVYKFIQKWQIQLHSAQFILKRLK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |