Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA020156_circ_g.3 |
ID in PlantcircBase | osi_circ_006337 |
Alias | 5:26657018|26658785 |
Organism | Oryza sativa ssp. indica |
Position | chr5: 26657018-26658785 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA020156 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | BGIOSGA020156_circ_g.1 BGIOSGA020156_circ_g.2 BGIOSGA020156_circ_g.4 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | BGIOSGA020156-TA:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_028464* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
26657042-26658730(-) 26657392-26657083(+) |
Potential amino acid sequence |
MVKPNLPSSSAVCSMSLWWPLELIAR*(-) MVLEATRKQRFERVTRNLKVTRLFSTLVEELKAIGLSSHVEAPRSDVMVPAAHCDRSPVLLLMG GGMGAGKSTVLKDILKEAFWSGAAANAVVVEADAFKETDVIYRAISSRGHHNDMLQTAELLGKL GLTMWMNAPTYVRWPMII*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |