Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0224800_circ_g.2 |
ID in PlantcircBase | osa_circ_027027 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 7637171-7637416 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0224800 |
Parent gene annotation |
Similar to Cytosine-specific methyltransferase. (Os05t0224800-01 ) |
Parent gene strand | - |
Alternative splicing | Os05g0224800_circ_g.1 Os05g0224800_circ_igg.1 Os05g0224800_circ_igg.2 Os05g0224800_circ_igg.3 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os05t0224800-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.558410105 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7637181-7637208(+) 7637350-7637180(+) 7637385-7637414(-) 7637178-7637414(-) |
Potential amino acid sequence |
MTECIFGIQFEDPLHTAFHHGFPHLPLLGDQKECLQGQLVLLVALVCHWANQPNYATLNDRMYL WNSV*(+) MSSRTIGLASCIGVSLGQPTKLRNIK*(+) MQLARPIVLEDILSDLPEVANGESRDEMLYVKGPQTEFQRYIRSFNVA*(-) MLRNLVGWPNDTPMQLARPIVLEDILSDLPEVANGESRDEMLYVKGPQTEFQRYIRSFNVA*(- ) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |