Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0224800_circ_g.2 |
| ID in PlantcircBase | osa_circ_027027 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 7637171-7637416 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0224800 |
| Parent gene annotation |
Similar to Cytosine-specific methyltransferase. (Os05t0224800-01 ) |
| Parent gene strand | - |
| Alternative splicing | Os05g0224800_circ_g.1 Os05g0224800_circ_igg.1 Os05g0224800_circ_igg.2 Os05g0224800_circ_igg.3 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0224800-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.558410105 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7637181-7637208(+) 7637350-7637180(+) 7637385-7637414(-) 7637178-7637414(-) |
| Potential amino acid sequence |
MTECIFGIQFEDPLHTAFHHGFPHLPLLGDQKECLQGQLVLLVALVCHWANQPNYATLNDRMYL WNSV*(+) MSSRTIGLASCIGVSLGQPTKLRNIK*(+) MQLARPIVLEDILSDLPEVANGESRDEMLYVKGPQTEFQRYIRSFNVA*(-) MLRNLVGWPNDTPMQLARPIVLEDILSDLPEVANGESRDEMLYVKGPQTEFQRYIRSFNVA*(- ) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |