Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.007G335200_circ_g.1 |
| ID in PlantcircBase | gra_circ_000780 |
| Alias | Chr07:55961773|55962134 |
| Organism | Gossypium raimondii |
| Position | chrChr07: 55961773-55962134 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.007G335200 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | orai.007G335200_circ_g.2 |
| Support reads | 4 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.007G335200.3:2 Gorai.007G335200.2:2 Gorai.007G335200.4:2 Gorai.007G335200.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ghi_circ_000472* |
| PMCS | 0.439686924 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
55962127-55962085(-) |
| Potential amino acid sequence |
MAGAIPAQGTNGAASGGIMEMMGLKKSTKPARSSFSVLCGERRKKIKTLFPYEEFVKFFQCEAF DLSPRGLLNIGNSFGNGGCHSGTRNQWGS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |