Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0247800_circ_g.10 |
ID in PlantcircBase | osa_circ_030389 |
Alias | Os_ciR10808 |
Organism | Oryza sativa |
Position | chr6: 7664572-7665126 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os06g0247800 |
Parent gene annotation |
Similar to Dynamin-like protein (Fragment). (Os06t0247800-01);No n-protein coding transcript. (Os06t0247800-02) |
Parent gene strand | + |
Alternative splicing | Os06g0247800_circ_g.1 Os06g0247800_circ_g.2 Os06g0247800_circ_g.3 Os06g0247800_circ_g.4 Os06g0247800_circ_g.5 Os06g0247800_circ_g.6 Os06g0247800_circ_g.7 Os06g0247800_circ_g.8 Os06g0247800_circ_g.9 |
Support reads | 2/1 |
Tissues | root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os06t0247800-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_016862 |
PMCS | 0.400513363 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7664592-7664580(+) 7664706-7664911(-) |
Potential amino acid sequence |
MVQDELARLGESMVQSAEGTRAVALELCREFEDKFLAHITSGEGSGWKVVASFEGKFPERIKQL PLDRHFDLSNVKRIVLEADGYQPYLISPEKGLRSLIKIVLDMAKEPSRLCVEESSG*(+) MSKKLILEFPAEFQSNSPSPFSTLYHRFSQPCQFILNHLGLTLKTLQHRVVMAPLPYPILSLSR TSTLSLEISGTVDNHRLPRQSF*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |