Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0495700_circ_g.1 |
| ID in PlantcircBase | osa_circ_030940 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 17276334-17277714 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0495700 |
| Parent gene annotation |
Beta tubulin, autoregulation binding site domain containing prot ein. (Os06t0495700-00) |
| Parent gene strand | + |
| Alternative splicing | Os06g0495700_circ_igg.1 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0495700-00:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.109905787 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17277637-17276346(+) 17276605-17276346(+) |
| Potential amino acid sequence |
MMIRSRYMIASSHWAQLLWVIHQTLKAIRGVKRARVESTEPSVRVIYSNLTRESKRKLVELMQQ WSEWQTRKQNTLTKAGEEVLECGEETYYPALHVGSEKSCAVSFWVDSQAKEGVVLDDDSVPLYD REFTLGSTPLGDPSNTESNQRS*(+) MQQWSEWQTRKQNTLTKAGEEVLECGEETYYPALHVGSEKSCAVSFWVDSQAKEGVVLDDDSVP LYDREFTLGSTPLGDPSNTESNQRS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |