Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0659500_circ_g.1 |
ID in PlantcircBase | osa_circ_035148 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 27791810-27792147 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0659500 |
Parent gene annotation |
Non-SMC condensin subunit, XCAP-D2/Cnd1 family protein. (Os07t06 59500-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os07t0659500-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_017433 |
PMCS | 0.103303748 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
27792082-27791847(+) 27792084-27792134(-) |
Potential amino acid sequence |
MFSLSSELLSVDGSTTSLVSSATSARHTSHWSTVF*(+) MPECSDNICSEKSHTSSTFTESDGDSTEVQSARTSCKGVSRSRINKMREPEDSEDSAPMRRVSR RSGRGN*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |