Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0480900_circ_g.1 |
ID in PlantcircBase | osa_circ_014678 |
Alias | Os_ciR7727 |
Organism | Oryza sativa |
Position | chr2: 16538993-16539511 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os02g0480900 |
Parent gene annotation |
LsmAD domain domain containing protein. (Os02t0480900-01);Hypoth etical conserved gene. (Os02t0480900-02);Hypothetical conserved gene. (Os02t0480900-03) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2/2 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0480900-03:2 Os02t0480900-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.229659971 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
16539465-16539082(+) 16539283-16539382(-) |
Potential amino acid sequence |
MMKAQKRASLKMALPSHWRSKRCCRHVISIVVWSIRCWRLWRPHRS*(+) MGSLSSEKSSLNPNAKEFKLNPNAKSFTPSTSVRPPQPPASDGPYYYANNMPTAPLGPPMTWKC HLQARTLLSLHHLVKQRNPQKVYLQILLCLEKFLLRGNM*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |