Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0480900_circ_g.1 |
| ID in PlantcircBase | osa_circ_014678 |
| Alias | Os_ciR7727 |
| Organism | Oryza sativa |
| Position | chr2: 16538993-16539511 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os02g0480900 |
| Parent gene annotation |
LsmAD domain domain containing protein. (Os02t0480900-01);Hypoth etical conserved gene. (Os02t0480900-02);Hypothetical conserved gene. (Os02t0480900-03) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0480900-03:2 Os02t0480900-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.229659971 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16539465-16539082(+) 16539283-16539382(-) |
| Potential amino acid sequence |
MMKAQKRASLKMALPSHWRSKRCCRHVISIVVWSIRCWRLWRPHRS*(+) MGSLSSEKSSLNPNAKEFKLNPNAKSFTPSTSVRPPQPPASDGPYYYANNMPTAPLGPPMTWKC HLQARTLLSLHHLVKQRNPQKVYLQILLCLEKFLLRGNM*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |