Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0233400_circ_g.2 |
| ID in PlantcircBase | osa_circ_036418 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 8110524-8113955 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0233400 |
| Parent gene annotation |
Ankyrin repeat domain containing protein. (Os08t0233400-01) |
| Parent gene strand | - |
| Alternative splicing | Os08g0233400_circ_g.3 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0233400-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_007617* |
| PMCS | 0.10343861 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8112665-8113943(-) |
| Potential amino acid sequence |
MGNDGSTECLNFLMEAGANYGGPNDDQHVNKKKIEELKTSGNKAVDREDYISASAFYTKEIVK* (-) |
| Sponge-miRNAs | osa-miR1847.1 osa-miR396a-5p |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |