Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G69400_circ_g.1 |
| ID in PlantcircBase | ath_circ_009320 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 26087688-26087939 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
| Parent gene | AT1G69400 |
| Parent gene annotation |
Mitotic checkpoint protein BUB3.3 |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G69400.1:1 AT1G69400.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.10449709 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26087837-26087936(+) |
| Potential amino acid sequence |
MHIYDLRNLDEAFQSYASQVEVPIRCITSVPYSRGEVISTGFDEKIKFWDTRQRESLVFSTDAG GAVGCVTVSGNNLVVCVDASMHIYDLRNLDEAFQSYASQVEVPIRCITSVPYSRGEVISTGFDE KIKFWDTRQRESLVFSTDAGGAVGCVTVSGNNLVVCVDASMHIYDLRNLDEAFQSYASQVEVPI RCITSVPYSRGEVISTGFDEKIKFWDTRQRESLVFSTDAGGAVGCVTVSGNNLVVCVDASMHIY DLRNLDEAFQSYASQVEVPIRCITSVPYSR(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |