Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.010G175600_circ_g.2 |
| ID in PlantcircBase | gra_circ_001135 |
| Alias | Chr10:51469706|51478469 |
| Organism | Gossypium raimondii |
| Position | chrChr10: 51469706-51478469 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.010G175600 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | orai.010G175600_circ_g.1 |
| Support reads | 5 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.010G175600.1:5 Gorai.010G175600.4:5 Gorai.010G175600.3:5 Gorai.010G175600.6:5 Gorai.010G175600.2:5 Gorai.010G175600.5:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.09404557 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
51469742-51469709(+) 51478433-51469728(+) |
| Potential amino acid sequence |
MTQEEMLLEAAQTEIMNLRNLERVLAREEEVKKRAIIHKAVYSGPQIKYVSKEGSSYLEFSKGL TFHSELSTTPLPYPEKAMCAVTGLPARYRDPKTGLCYATKEAFKIIRERQ*(+) MQQRKPLKLFENANKKEKRR*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |