Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0435700_circ_g.5 |
| ID in PlantcircBase | osa_circ_023900 |
| Alias | Os_ciR9347 |
| Organism | Oryza sativa |
| Position | chr4: 21687348-21687575 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os04g0435700 |
| Parent gene annotation |
Similar to UVB-resistance protein UVR8. (Os04t0435700-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0435700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.223948757 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21687362-21687365(+) 21687554-21687365(+) 21687561-21687545(-) 21687545-21687545(-) |
| Potential amino acid sequence |
MIDALSPDGPGCKKLEPSTAVPFAAKVWVSPSERYAIVPDEKEQTCDD*(+) MPLFLMKKNKPVMIDALSPDGPGCKKLEPSTAVPFAAKVWVSPSERYAIVPDEKEQTCDD*(+) MAYLSDGETQTLAANGTAVDGSNFLQPGPSGLKASIITGLFFFIRNNGISF*(-) MARPRLWLQMVQLLMALISCSQDHPGLRHQSSQVCSFSSGTMAYLSDGETQTLAANGTAVDGSN FLQPGPSGLKASIITGLFFFIRNNGISF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |