Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0741100_circ_g.2 |
| ID in PlantcircBase | osa_circ_016485 |
| Alias | Os_ciR8079 |
| Organism | Oryza sativa |
| Position | chr2: 30998115-30998404 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os02g0741100 |
| Parent gene annotation |
Similar to Chaperone protein dnaJ 16 (Protein ARG1-LIKE1) (AtARL 1) (AtJ16) (AtDjB16). (Os02t0741100-01);Similar to Chaperone pro tein dnaJ 16 (Protein ARG1-LIKE1) (AtARL1) (AtJ16) (AtDjB16). (O s02t0741100-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/4 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0741100-02:1 Os02t0741100-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_004267* osi_circ_012269 |
| PMCS | 0.546990086 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30998355-30998396(+) 30998371-30998158(-) |
| Potential amino acid sequence |
MVQHPFESRQEKTLLRKIDELLKERNAIHASYTNNTTLQRSSSSNKGKTSSKESKSDDDQTVKK EKKSKSKSMEGSRSDDDGPRKEKKPKERLRRKKWFNIHLKVDKRRPC*(+) MDVEPFLPSKSFLRFLFLSRTIIITSGSLHGLALRFLFLFHSLVIITFGLFRGCFPFVATGTPL QSCVVGVGCMNCIPFLEKLVDLPQQGLLLSTFKWMLNHFFLRSRSLGFFSFLGPSSSLLDPSMD LLFDFFSFFTVWSSSLLDSLEDVFPLLLLELRCRVVLLV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |