Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0715500_circ_g.5 |
| ID in PlantcircBase | osa_circ_021289 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 28973409-28973620 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0715500 |
| Parent gene annotation |
Armadillo-type fold domain containing protein. (Os03t0715500-01) ;Armadillo-type fold domain containing protein. (Os03t0715500-02 );Similar to TVLP1. (Os03t0715500-03) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0715500-01:1 Os03t0715500-02:1 Os03t0715500-03:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.405217296 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28973510-28973431(+) 28973566-28973599(-) |
| Potential amino acid sequence |
MIIYSFLIPRQMLSPHQAIDFTVSGTPNSFTSTNSLPPFPGGAPQ*(+) MAWCGDNICLGIRKEYMIINSMTGALTEVFSSGRNAPPLVVALPTGELLLGKVGGSLLR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |