Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0525900_circ_g.10 |
| ID in PlantcircBase | osa_circ_024627 |
| Alias | Os_ciR9473 |
| Organism | Oryza sativa |
| Position | chr4: 26306091-26306219 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os04g0525900 |
| Parent gene annotation |
Major facilitator superfamily protein. (Os04t0525900-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0525900-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.598176163 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26306149-26306216(+) 26306144-26306154(-) |
| Potential amino acid sequence |
MAMSTVAIHIFGDVPSSPLVGLLQAPVNYVCLHCVKPSLRPLSMAMSTVAIHIFGDVPSSPLVG LLQAPVNYVCLHCVKPSLRPLSMAMSTVAIHIFGDVPSSPLVGLLQAPVNYVCLHCVKPSLRPL SMAMSTVAIHIFGDVPSSPLVGLLQ(+) MAANLVLHNEGIHSLLGPEEAQQEVKKAHHQIYGLQQLT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |