Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | POPTR_0003s10090_circ_g.2 |
| ID in PlantcircBase | pop_circ_001015 |
| Alias | Chr03:12717096-12718363 |
| Organism | Populus trichocarpa |
| Position | chr3: 11203031-11204298 JBrowse» |
| Reference genome | Populus trichocarpa genome v3.0 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | POPTR_0003s10090 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | POPTR_0003s10090_circ_g.3 |
| Support reads | NA |
| Tissues | stem xylem |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | POPTR_0003s10090.1:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.140904377 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11204275-11203273(+) 11203704-11204270(-) 11203927-11204274(-) |
| Potential amino acid sequence |
MDFETNRFSERKDVVEHLQLKASCKDPRSKAT*(+) MGLILQGLLTTNFHSLLVFTFPHLSHQQVRMQSTLSSRFAPGILARGLQLQMLYNILSFREPVG LKIHN*(-) MWAMGAIMAELFTLRPLFPGTSEADEIYKICSVIGSPTTDTWADGLNLARAINYQFPQFAGVHL PTLIPSASEDAINLIKSLCSWDPCTRPSAADALQHPFFQRTCWSQNP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Liu et al., 2021 |