Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.006G135500_circ_g.1 |
| ID in PlantcircBase | gra_circ_000624 |
| Alias | Chr06:39141258|39141910 |
| Organism | Gossypium raimondii |
| Position | chrChr06: 39141258-39141910 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.006G135500 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.006G135500.5:2 Gorai.006G135500.1:2 Gorai.006G135500.4:1 Gorai.006G135500.3:2 Gorai.006G135500.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.565094755 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
39141264-39141261(+) 39141856-39141286(+) 39141549-39141889(-) |
| Potential amino acid sequence |
MNFKVPQPDDDFDYYGNSSQDESRGSQGGAMSHHGNGTMSERELSLAKRKWRGALNSDEEDDDY QGTHITEERYRSMLGEHVQKYKRRFKDTSASPAPSRMGIPAPKSNLGSSKNRKLLNEQRAGFYD METTSEWMNDVSSQRFANYHEADLVPNL*(+) MMLVLRGLQTIMKQILCPTFDELQSSTT*(+) MVRHCSTLATSALVLTTIPIIIKIIIRLWNFEVHQRLGTRSAS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |