Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0680700_circ_g.4 |
ID in PlantcircBase | osa_circ_003243 |
Alias | Os01circ20310/Os_ciR1022 |
Organism | Oryza sativa |
Position | chr1: 28018040-28018544 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder, SMALT, Segemehl, circseq_cup, find_circ |
Parent gene | Os01g0680700 |
Parent gene annotation |
Protein of unknown function DUF1639 family protein. (Os01t068070 0-01);Hypothetical conserved gene. (Os01t0680700-02);Hypothetica l conserved gene. (Os01t0680700-03) |
Parent gene strand | - |
Alternative splicing | Os01g0680700_circ_g.5 |
Support reads | 10/19/14/15 |
Tissues | leaf and panicle/root/root/shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0680700-02:1 Os01t0680700-03:2 Os01t0680700-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_002301* osi_circ_010565 |
PMCS | 0.590794215 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
28018459-28018090(+) 28018054-28018413(-) 28018461-28018361(-) |
Potential amino acid sequence |
MCSAASRADLCALSGDRLYPPPDRSSTADLLHTFLLSHLIPSSRQV*(+) MCEEGPPWRSDQAAGTSGRRTRRTSPPWTRRCTWIPRTTTITTTTTRR*(-) MDSKNNHHHHHHDSSVTANGGAGAGEKIGSERFELPRIYISLSRKEKEDDFLIMKGTKLPQRPK KRAKNVDKTLQYVFPGMWLSDLTRGRYEVREKKCVKKVRRGGAIRRRVQAVAGQGAQVRPGRGA AHGFQEQPPSPPPRLVGDRKRRRRRRREDRLRAV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |