Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0680700_circ_g.4 |
| ID in PlantcircBase | osa_circ_003243 |
| Alias | Os01circ20310/Os_ciR1022 |
| Organism | Oryza sativa |
| Position | chr1: 28018040-28018544 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, SMALT, Segemehl, circseq_cup, find_circ |
| Parent gene | Os01g0680700 |
| Parent gene annotation |
Protein of unknown function DUF1639 family protein. (Os01t068070 0-01);Hypothetical conserved gene. (Os01t0680700-02);Hypothetica l conserved gene. (Os01t0680700-03) |
| Parent gene strand | - |
| Alternative splicing | Os01g0680700_circ_g.5 |
| Support reads | 10/19/14/15 |
| Tissues | leaf and panicle/root/root/shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0680700-02:1 Os01t0680700-03:2 Os01t0680700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_002301* osi_circ_010565 |
| PMCS | 0.590794215 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28018459-28018090(+) 28018054-28018413(-) 28018461-28018361(-) |
| Potential amino acid sequence |
MCSAASRADLCALSGDRLYPPPDRSSTADLLHTFLLSHLIPSSRQV*(+) MCEEGPPWRSDQAAGTSGRRTRRTSPPWTRRCTWIPRTTTITTTTTRR*(-) MDSKNNHHHHHHDSSVTANGGAGAGEKIGSERFELPRIYISLSRKEKEDDFLIMKGTKLPQRPK KRAKNVDKTLQYVFPGMWLSDLTRGRYEVREKKCVKKVRRGGAIRRRVQAVAGQGAQVRPGRGA AHGFQEQPPSPPPRLVGDRKRRRRRRREDRLRAV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |