Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0132000_circ_g.3 |
| ID in PlantcircBase | osa_circ_008363 |
| Alias | Os_ciR7033 |
| Organism | Oryza sativa |
| Position | chr11: 1466215-1466553 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os11g0132000 |
| Parent gene annotation |
Similar to Arabinoxylan arabinofuranohydrolase isoenzyme AXAH-II . (Os11t0132000-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os11t0132000-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.382694494 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1466229-1466256(+) 1466225-1466496(-) |
| Potential amino acid sequence |
MASYAPLFVNENDRTWNPDAIVFNSWQQYGTPSYWMQTYFRESSGSVIHPVTISSSYFDLLAAS AITWQDNEDIFLRVKRCHSDGKLCTTLRE*(+) MTSLYPQKDILIVLPGDCRCCQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |