Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0646900_circ_g.5 |
ID in PlantcircBase | osa_circ_020788 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 25043838-25044037 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
Parent gene | Os03g0646900 |
Parent gene annotation |
Similar to Serine/threonine protein phosphatase. (Os03t0646900-0 1) |
Parent gene strand | - |
Alternative splicing | Os03g0646900_circ_g.1 Os03g0646900_circ_g.2 Os03g0646900_circ_g.3 Os03g0646900_circ_g.4 Os03g0646900_circ_g.6 |
Support reads | 12 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0646900-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_013366 |
PMCS | 0.742409032 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
25044006-25044003(-) 25043942-25044035(-) 25043842-25044003(-) |
Potential amino acid sequence |
MNRLFNWLPLAALIEKKIICMHGGIGRSINHVEQIENLQRPITMEAGSVVLMDLLWVREMVFGH GTE*(-) MVELVGQSTMLSKLRIFRDQLPWKQALLSLWIFYG*(-) MGERDGIWTWHRMNRLFNWLPLAALIEKKIICMHGGIGRSINHVEQIENLQRPITMEAGSVVLM DLLWVREMVFGHGTE*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |