Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0646900_circ_g.5 |
| ID in PlantcircBase | osa_circ_020788 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 25043838-25044037 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | Os03g0646900 |
| Parent gene annotation |
Similar to Serine/threonine protein phosphatase. (Os03t0646900-0 1) |
| Parent gene strand | - |
| Alternative splicing | Os03g0646900_circ_g.1 Os03g0646900_circ_g.2 Os03g0646900_circ_g.3 Os03g0646900_circ_g.4 Os03g0646900_circ_g.6 |
| Support reads | 12 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0646900-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_013366 |
| PMCS | 0.742409032 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25044006-25044003(-) 25043942-25044035(-) 25043842-25044003(-) |
| Potential amino acid sequence |
MNRLFNWLPLAALIEKKIICMHGGIGRSINHVEQIENLQRPITMEAGSVVLMDLLWVREMVFGH GTE*(-) MVELVGQSTMLSKLRIFRDQLPWKQALLSLWIFYG*(-) MGERDGIWTWHRMNRLFNWLPLAALIEKKIICMHGGIGRSINHVEQIENLQRPITMEAGSVVLM DLLWVREMVFGHGTE*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |