Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0125350_circ_g.7 |
| ID in PlantcircBase | osa_circ_012901 |
| Alias | Os_ciR7675 |
| Organism | Oryza sativa |
| Position | chr2: 1329676-1329831 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os02g0125350 |
| Parent gene annotation |
Hypothetical gene. (Os02t0125350-00) |
| Parent gene strand | - |
| Alternative splicing | Os02g0125300_circ_g.5 Os02g0125350_circ_g.6 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0125300-01:1 Os02t0125300-02:1 Os02t0125300-01:1 Os02t0125350-00:1 Os02t0125300-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.312500321 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1329710-1329828(+) 1329717-1329691(+) |
| Potential amino acid sequence |
MVYDTQEIIERAHHGDMDYIKHALTLFTDFVAVLVRILVIMVYFGLLIFLGYMVYDTQEIIERA HHGDMDYIKHALTLFTDFVAVLVRILVIMVYFGLLIFLGYMVYDTQEIIERAHHGDMDYIKHAL TLFTDFVAVLVRILVIMVYFGLLIFLGYMVYDTQEIIERAHHGDMDYIKHALTLFTDFVAVLVR ILVIM(+) MTRRRSSRGLTTVTWTTSSTHSPSSLTSWPSLSGSSSSWFTLAC*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |