Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.002G222900_circ_g.1 |
| ID in PlantcircBase | gra_circ_000200 |
| Alias | Chr02:57776300|57777365 |
| Organism | Gossypium raimondii |
| Position | chrChr02: 57776300-57777365 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.002G222900 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.002G222900.7:4 Gorai.002G222900.8:3 Gorai.002G222900.2:4 Gorai.002G222900.5:4 Gorai.002G222900.1:4 Gorai.002G222900.4:4 Gorai.002G222900.3:4 Gorai.002G222900.6:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.546201266 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
57777248-57777347(-) 57777314-57776370(+) |
| Potential amino acid sequence |
MCELLRINCDRGVMLADGKTRFSINGKPIYHFVGTSTFSQYTVVHVGQVAKISPTAPLDKVCPI SCGICTGFGATVNVAKPKKGQTVAVFGLGAVGLAAAEGARVCGASRIIAVDVNPRRFEEEFVNP KDYDKPVQEVIVEMTGGGVDRSVECTGSVQAMISAFECVHDGWGVCVLVGVPKKDDAFKTHPMN LLSERTLKGAFYGNYKPRTDIPMVVDKYLNKDRGECG*(-) MISRFQIIHTLTHTLHDPCSNICRQPWEYQCVVYSCHKKHP*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |