Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G51980_circ_g.6 |
| ID in PlantcircBase | ath_circ_006902 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 19324695-19325168 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT1G51980 |
| Parent gene annotation |
Probable mitochondrial-processing peptidase subunit alpha-1, mit ochondrial |
| Parent gene strand | - |
| Alternative splicing | AT1G51980_circ_g.1 AT1G51980_circ_g.2 AT1G51980_circ_g.3 AT1G51980_circ_g.4 AT1G51980_circ_g.5 AT1G51980_circ_g.7 AT1G51980_circ_g.8 AT1G51980_circ_g.9 AT1G51980_circ_g.10 AT1G51980_circ_g.11 |
| Support reads | 2 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G51980.1:3 AT1G51980.2:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.217555363 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19324986-19324697(-) |
| Potential amino acid sequence |
MLMGGGGSFSAGGPGKGMHSWLYRRVLNEYQEVQSCTAFTSIFNDTGLFGIYGCSATHFAVAFE VPGWNNEKEAVTATVLQMLMGGGGSFSAGGPGKGMHSWLYRRVLNEYQEVQSCTAFTSIFNDTG LFGIYGCSATHFAVAFEVPGWNNEKEAVTATVLQMLMGGGGSFSAGGPGKGMHSWLYRRVLNEY QEVQSCTAFTSIFNDTGLFGIYGCSATHFAVAFEVPGWNNEKEAVTATVLQMLMGGGGSFSAGG PGKGMHSWLYRRVLNEYQEVQSCTAFTSIFNDTGLFGIYGCS(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |