Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G12430_circ_g.7 |
| ID in PlantcircBase | ath_circ_037822 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr5: 4031861-4032100 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
| Parent gene | AT5G12430 |
| Parent gene annotation |
Heat shock protein DnaJ with tetratricopeptide repeat-containing protein |
| Parent gene strand | - |
| Alternative splicing | AT5G12430_circ_g.6 |
| Support reads | 13 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT5G12430.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.391591743 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4031989-4031863(-) |
| Potential amino acid sequence |
MLCYSNRAATRMALGRMREAIADCTMASSIDSNFLKVQVRAAKGNNAYKIGDLSRAEESYTQGI DSVPRIETSRNCLRALMLCYSNRAATRMALGRMREAIADCTMASSIDSNFLKVQVRAAKGNNAY KIGDLSRAEESYTQGIDSVPRIETSRNCLRALMLCYSNRAATRMALGRMREAIADCTMASSIDS NFLKVQVRAAKGNNAYKIGDLSRAEESYTQGIDSVPRIETSRNCLRALMLCYSNRAATRMALGR MREAIADCTMASSIDSNFLKVQVRAA(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |