Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA009456_circ_g.2 |
ID in PlantcircBase | osi_circ_005261 |
Alias | 3:39902233|39903331 |
Organism | Oryza sativa ssp. indica |
Position | chr3: 39902233-39903331 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA009456 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | BGIOSGA009456_circ_g.1 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA009456-TA:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_022679* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
39902975-39903321(-) 39902268-39903233(-) |
Potential amino acid sequence |
MEKSRIALSIRQLEEDPLLETLDKVIPLEADQSPSAGIISSDSSPSEADLLPGLDGICNELLQE DGWSK*(-) MVYVMNYCKRMGGRSERGRKEACLLREGCKLVHSFFSSQDWCYL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |