Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G26470_circ_g.2 |
ID in PlantcircBase | ath_circ_014982 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 11261810-11262177 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | AT2G26470 |
Parent gene annotation |
At2g26470 |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G26470.2:2 AT2G26470.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.18238913 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11262081-11261812(-) |
Potential amino acid sequence |
MKWGLVPSFTKKTDKPDFFKMFNARSESVAEKASFRRLLPKNRCLVAVDGYRPSYNVAPGSYIP VLRRDNEEVVGDGVVVHCMKWGLVPSFTKKTDKPDFFKMFNARSESVAEKASFRRLLPKNRCLV AVDGYRPSYNVAPGSYIPVLRRDNEEVVGDGVVVHCMKWGLVPSFTKKTDKPDFFKMFNARSES VAEKASFRRLLPKNRCLVAVDGYRPSYNVAPGSYIPVLRRDNEEVVGDGVVVHCMKWGLVPSFT KKTDKPDFFKMFNARSESVAEKASFRRLLPKNRCLVAVD(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |