Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | BGIOSGA015478_circ_g.13 |
| ID in PlantcircBase | osi_circ_005340 |
| Alias | 4:7578121|7583070 |
| Organism | Oryza sativa ssp. indica |
| Position | chr4: 7578121-7583070 JBrowse» |
| Reference genome | Oryza_indica.ASM465v1.42 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | BGIOSGA015478 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | BGIOSGA015478_circ_g.9 BGIOSGA015478_circ_g.10 BGIOSGA015478_circ_g.11 BGIOSGA015478_circ_g.12 BGIOSGA015478_circ_g.14 BGIOSGA015478_circ_g.15 BGIOSGA015478_circ_g.16 BGIOSGA015478_circ_g.17 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | BGIOSGA015478-TA:8 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | zma_circ_007223* |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7582989-7582986(-) |
| Potential amino acid sequence |
MISAFSISMTLKQHPVIWSAANLPHDAYQLLAVPPPISGVLVICANSIHYHSQSTSCSLDLNNF SSHPDGSPEISKSNFQVELDAAKATWFSNDIVMFSSKAGEMLLLTVVYDGRVVQRLDLMKSKAS VLSSAVTSIGNSFFFLGSRLGDSLLVQFSYGASKSVLQDLTNERSADIEGDLPFSKRLKRIPSD VLQDVTSVEELSFQNIIAPNSLESAQKISYIVRDALINVGPLKDFSYGLRANADPNAMGNAKQS NYELVILSLCWSYFMSKSLHGLGVSYQSTIHA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Huang et al., 2021 |