Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d023431_circ_g.1 |
ID in PlantcircBase | zma_circ_000079 |
Alias | NA |
Organism | Zea mays |
Position | chr10: 5424667-5424769 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | SMALT, Segemehl |
Parent gene | Zm00001d023431 |
Parent gene annotation |
Signal recognition particle 54 kDa protein chloroplastic |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d023431_T001:1 Zm00001d023431_T002:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.311489887 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5424688-5424714(+) 5424759-5424764(-) |
Potential amino acid sequence |
MASTTRRTSVGFTAFFTSFNSFIIALSTCSFLASHGINHKKNFCRIHCFFYFFQLIHHCFIYLQ LLGQSWHQPQEELL*(+) MMNELKEVKKAVNPTEVLLVVDAMTGQEAAGR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015 |