Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0475300_circ_g.1 |
ID in PlantcircBase | osa_circ_028225 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 23353004-23353820 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0475300 |
Parent gene annotation |
VHS domain containing protein. (Os05t0475300-01) |
Parent gene strand | + |
Alternative splicing | Os05g0475300_circ_g.2 Os05g0475300_circ_g.3 Os05g0475300_circ_g.4 Os05g0475300_circ_g.5 Os05g0475300_circ_g.6 Os05g0475300_circ_g.7 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0475300-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.147697032 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23353280-23353048(+) 23353711-23353818(-) |
Potential amino acid sequence |
MMKNCGEYVHFEVVEQHILQEMVRIVQKKHDTQVRDKVLILLDSWQEAFGGPGGKYPQYYWSYI ELKANKGCGKSCEEAVAT*(+) MLLLDNSNHFLQNMLFNNFKMDIFTTVLHHCLQQRQSEKLNSWIFMLQPLLHSFYHILCLP*(- ) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |