Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0248800_circ_g.1 |
| ID in PlantcircBase | osa_circ_036519 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 9072673-9074009 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, CIRI, KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
| Parent gene | Os08g0248800 |
| Parent gene annotation |
Similar to Aspartate carbamoyltransferase 3, chloroplast precurs or (EC 2.1.3.2) (Aspartate transcarbamylase 3) (ATCase 3). (Os08 t0248800-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 6 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0248800-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_018396 |
| PMCS | 0.416954918 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9073880-9072769(+) 9072727-9073993(-) 9073021-9074003(-) |
| Potential amino acid sequence |
MLPWPIACINNWNVCSGGCSPCSPTFKMSQNNNIRITLNSPYGISSSLGRGCMITACFGSTSKT FLSTMYLPRAAS*(+) MCCQNMLLSCIPFQGLMRYHKDC*(-) MKDDIKEYLTSQGVEWEESSDLLEVASKCDVIYQTRIQKERFGERIDLYEAARGKYIVDKKVLD VLPKHAVIMHPLPRLDEIP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |