Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0103100_circ_g.2 |
ID in PlantcircBase | osa_circ_038380 |
Alias | NA |
Organism | Oryza sativa |
Position | chr9: 413501-413948 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ie-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os09g0103150 |
Parent gene annotation |
Hypothetical protein. (Os09t0103150-00) |
Parent gene strand | - |
Alternative splicing | Os09g0103100_circ_g.1 Os09g0103100_circ_g.3 Os09g0103100_circ_g.4 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os09t0103100-01:2 Os09t0103100-01:2 Os09t0103150-00:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.145293304 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
413879-413826(+) 413822-413826(-) |
Potential amino acid sequence |
MFGLGMSVERVGVKVIQPFLFMIRLKQKMDSFYLFSISHMAKIKQQIVLALQFFFNMVFFREET HGS*(+) MCLLPEKDHVEEKLEGQYYLLLYFCHVGYAEEIKGIHLLFQPYHEQKRLNDLYSNAFHGHSQSK HQNRYQQGYTQVIAQQSL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |