Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0114500_circ_g.1 |
| ID in PlantcircBase | osa_circ_029428 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 832926-833075 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0114500 |
| Parent gene annotation |
Similar to ATOZI1 protein (Stress-induced protein OZI1) (AT0ZI1 protein). (Os06t0114500-01);Similar to ATOZI1 protein (Stress-in duced protein OZI1) (AT0ZI1 protein). (Os06t0114500-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-GC |
| Number of exons covered | Os06t0114500-02:1 Os06t0114500-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.329439 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
833063-833072(+) |
| Potential amino acid sequence |
MWCGATLGLEILDDEVLATDGVHDNRWPSSARPGLKLLVSCLPPFLVGHGMWCGATLGLEILDD EVLATDGVHDNRWPSSARPGLKLLVSCLPPFLVGHGMWCGATLGLEILDDEVLATDGVHDNRWP SSARPGLKLLVSCLPPFLVGHGMWCG(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |