Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0482100_circ_g.4 |
ID in PlantcircBase | osa_circ_037397 |
Alias | Os_ciR11507 |
Organism | Oryza sativa |
Position | chr8: 23839452-23839640 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os08g0482100 |
Parent gene annotation |
LETM1-like domain containing protein. (Os08t0482100-01);Similar to predicted protein. (Os08t0482100-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os08t0482100-01:1 Os08t0482100-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_017995 |
PMCS | 0.254403351 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23839570-23839637(+) |
Potential amino acid sequence |
MIRRLKKEAEFLEASFRAKTEFLESLESVEEALVKLEDLLQELHLSSSNSGKEDLRAACSDLEM IRRLKKEAEFLEASFRAKTEFLESLESVEEALVKLEDLLQELHLSSSNSGKEDLRAACSDLEMI RRLKKEAEFLEASFRAKTEFLESLESVEEALVKLEDLLQELHLSSSNSGKEDLRAACSDLEMIR RLKKEAEFLEASFRAKTEFLE(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |