Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0482100_circ_g.4 |
| ID in PlantcircBase | osa_circ_037397 |
| Alias | Os_ciR11507 |
| Organism | Oryza sativa |
| Position | chr8: 23839452-23839640 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os08g0482100 |
| Parent gene annotation |
LETM1-like domain containing protein. (Os08t0482100-01);Similar to predicted protein. (Os08t0482100-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0482100-01:1 Os08t0482100-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_017995 |
| PMCS | 0.254403351 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23839570-23839637(+) |
| Potential amino acid sequence |
MIRRLKKEAEFLEASFRAKTEFLESLESVEEALVKLEDLLQELHLSSSNSGKEDLRAACSDLEM IRRLKKEAEFLEASFRAKTEFLESLESVEEALVKLEDLLQELHLSSSNSGKEDLRAACSDLEMI RRLKKEAEFLEASFRAKTEFLESLESVEEALVKLEDLLQELHLSSSNSGKEDLRAACSDLEMIR RLKKEAEFLEASFRAKTEFLE(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |