Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0430100_circ_g.7 |
ID in PlantcircBase | osa_circ_023851 |
Alias | Os_ciR5417 |
Organism | Oryza sativa |
Position | chr4: 21331214-21331349 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ie-circRNA |
Identification method | find_circ |
Parent gene | Os04g0430150 |
Parent gene annotation |
Hypothetical gene. (Os04t0430150-00) |
Parent gene strand | - |
Alternative splicing | Os04g0430100_circ_g.1 Os04g0430100_circ_g.2 Os04g0430100_circ_g.3 Os04g0430100_circ_g.4 Os04g0430100_circ_g.5 Os04g0430100_circ_g.6 |
Support reads | 3 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os04t0430100-01:1 Os04t0430100-01:1 Os04t0430150-00:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.734772243 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21331262-21331228(+) 21331343-21331347(-) |
Potential amino acid sequence |
MGTVVVLVVLLVTLVVRRVELLLSSSHPLGGPPRFEGDRPRFGDRDGYRGGPRGAPGDFGGEKG GAPAEFQPSFRGPASL*(+) MAGTQQELHPSHHQSHQEHHEDHHGTHLCHQTLACPLQSEAGPLKDGWNSAGAPPFSPPKSPGA PRGPPRYPSLSPNLGLSPSKRGGPPKGWLELSRSSTLLTTKVTRSTTRTTTVPISVTKPWPVPF KARRAP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |