Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G33950_circ_g.1 |
| ID in PlantcircBase | ath_circ_034517 |
| Alias | AT4G33950_C1, CircSRK2E |
| Organism | Arabidpsis thaliana |
| Position | chr4: 16273502-16273954 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | AT4G33950 |
| Parent gene annotation |
Serine/threonine-protein kinase SRK2E |
| Parent gene strand | + |
| Alternative splicing | AT4G33950_circ_g.2 AT4G33950_circ_g.3 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT4G33950.2:2 AT4G33950.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.355949351 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16273890-16273951(+) 16273585-16273571(+) |
| Potential amino acid sequence |
MLVGAYPFEDPEEPKNFRKTIHSSVLHSQPKSTVGTPAYIAPEVLLKKEYDGKVADVWSCGVTL YVMLVGAYPFEDPEEPKNFRKTIHSSVLHSQPKSTVGTPAYIAPEVLLKKEYDGKVADVWSCGV TLYVMLVGAYPFEDPEEPKNFRKTIHSSVLHSQPKSTVGTPAYIAPEVLLKKEYDGKVADVWSC GVTLYVMLVGAYPFEDPEEPKNFRKTIH MMERLQMFGLVGLLCMSCWLEHILSKIPRNQRISGKLYIHQCYIRNQNQLLELLLTSLLRFY* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Zhang et al., 2019 |